PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_13500
Common NameKK1_013912
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 324aa    MW: 36332.6 Da    PI: 6.1682
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_13500genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.18.5e-131966148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l ++      g+W+ +ar  g+ R++k+c++rw +yl
    C.cajan_13500 19 KGLWSPEEDDKLMNYMLNNAQGCWSDVARNAGLQRCGKSCRLRWINYL 66
                     678*******************************************97 PP

2Myb_DNA-binding52.41.2e-1672115146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+el+++++ +lG++ W+ Ia++++ gRt++++k++w++
    C.cajan_13500  72 RGAFSPQEEELIIHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 115
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.2651466IPR017930Myb domain
SuperFamilySSF466891.21E-2617113IPR009057Homeodomain-like
SMARTSM007179.0E-81868IPR001005SANT/Myb domain
PfamPF002492.0E-111966IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-212073IPR009057Homeodomain-like
CDDcd001671.65E-62266No hitNo description
PROSITE profilePS5129425.91867121IPR017930Myb domain
SMARTSM007174.9E-1671119IPR001005SANT/Myb domain
PfamPF002492.0E-1572115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-2674122IPR009057Homeodomain-like
CDDcd001671.83E-1174114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MRKPEAYGTK NKNCSKLRKG LWSPEEDDKL MNYMLNNAQG CWSDVARNAG LQRCGKSCRL  60
RWINYLRPDL KRGAFSPQEE ELIIHLHSLL GNRWSQIAAR LPGRTDNEIK NFWNSTIKKR  120
LKNMSSTTTT STSPNASESS SEPSKDLNMG GFMSTQQHHQ HARFVPMFAS SPSPSPSMQT  180
TVFNTMIERL PMLEHGSTMQ PSGGYFEGIG SCFSQSEVYN KGSYLENGVF GSVNIGVEGD  240
MFVPPLENVS TTVNHNNLSS TCMGETNNSY FDDINSILNN CNVGIAENKA GVENLFQQEL  300
ATGEWDFEEF MKDISSFPFV DFSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26171215108B-MYB
1h8a_C4e-261712125128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014496698.11e-178PREDICTED: transcription factor MYB46-like
SwissprotQ9LXV22e-74MYB46_ARATH; Transcription factor MYB46
TrEMBLA0A151SUM90.0A0A151SUM9_CAJCA; Transcription factor MYB46
STRINGGLYMA15G03920.11e-163(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.19e-64myb domain protein 46